PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676765472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 479aa    MW: 52989.6 Da    PI: 9.0014
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676765472genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1535.4e-4816991194
      NF-YB 11 anvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
               an+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ng+dllwa+atlGfedy++plk+yl++yre +
  676765472 16 ANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGEDLLWAMATLGFEDYLDPLKIYLARYREGD 99
               9********************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.2E-4416111IPR009072Histone-fold
PfamPF008084.3E-241676IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.39E-3416113IPR009072Histone-fold
PRINTSPR006151.2E-194058No hitNo description
PROSITE patternPS0068504359IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-195977No hitNo description
PRINTSPR006151.2E-197896No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MADTPSSPAG DGGESANISR IMKKALPPNG KIGKDAKDTV QECVSEFISF ITSEASDKCQ  60
KEKRKTVNGE DLLWAMATLG FEDYLDPLKI YLARYREGDN KGSGKSGDGS NRDAAGGVPG  120
EDLPLKIYVR YENYLKEGKN CPQARVVFDP LLISKLECFS NFCCFQKSRI GKERTMDCQQ  180
VDSSSRVLDH EELFGSLKIG EDEIDVNHND LIKTLACVSS DTAARPSFAW NNAFFTEPGV  240
LDVEELSLVN DGFTSNLQPR NSADSMTTTT EGSRFSVSSI EFDLFNDLRA SLINSQNVRQ  300
TGAPEIQPKL PDAKKLMSSK FNISVLFPKR TKWYKLKIPP LSLIRQPKVY PSSSSSISKP  360
LTPRQAKPEK KTVASDFGKN NKGKHTKNGF EEKSGSKTIT RSSYSGDTVK DMTSSSSNLR  420
LPLPKMGFFD SEINVGKENE DPNSANRTRR QYKSKLETFP PQGNPSVLGQ RKTRNCNGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-3716971293NF-YB
4awl_B4e-3716971394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-3716971394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532481e-117AK353248.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-27-P17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133310.11e-107PREDICTED: uncharacterized protein LOC103857826
RefseqXP_013739085.11e-107PREDICTED: uncharacterized protein LOC106441879
TrEMBLM4C7C51e-163M4C7C5_BRARP; Uncharacterized protein
STRINGBra000103.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1505322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.73e-66nuclear factor Y, subunit B1